PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033834001
Common NameGSBRNA2T00033834001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 290aa    MW: 31872.6 Da    PI: 5.4453
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033834001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY354.71.7e-10812881284
              FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                          mdpe f++ lf+w+p  a++++p+  ++   ++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m
  GSBRNA2T00033834001   1 MDPEGFTSGLFRWNPTRAMVQQPSPPVPPPPQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMM 90 
                          9*************77676666666666666677777788888888899***************************************** PP

              FLO_LFY  91 kslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqe..ekeaagsggeglgea 171
                          +sls+ifr++llvGeryG+kaavraerrrl e  e+++++rr+l+      + +++aldalsqeglseepv++  +++aag++g+g g +
  GSBRNA2T00033834001  91 NSLSHIFRWELLVGERYGVKAAVRAERRRLLEeeEQESSRRRHLIlsaagDSGTHHALDALSQEGLSEEPVHQleHTDAAGNNGGGGGYW 180
                          *****************************976334445677777778844344556***************9963333666777776677 PP

              FLO_LFY 172 elvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge....erqrehPfivtepgevargkknGLDYLfdLye 257
                          ++ +a+       kk +  +++++k++ + + e+d+d +e +d+d+ ++g +g     erqrehPfivtepgevargkknGLDYLf+Lye
  GSBRNA2T00033834001 181 DAGQAK------MKKPQ--QRRRKKQMVT-SVETDDDMNEGDDDDDGNGGGGGGvlgiERQREHPFIVTEPGEVARGKKNGLDYLFHLYE 261
                          665444......22222..2333333333.3344444444444444433333223555******************************** PP

              FLO_LFY 258 qCrefLlqvqkiakerGekcPtkvtnq 284
                          qCrefL+qvq+iak+rGekcPtkv  +
  GSBRNA2T00033834001 262 QCREFLIQVQTIAKDRGEKCPTKVSSK 288
                          ************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.1E-1161288IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QQPSPPVPPP PQQQPPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGVK AAVRAERRRL  120
LEEEEQESSR RRHLILSAAG DSGTHHALDA LSQEGLSEEP VHQLEHTDAA GNNGGGGGYW  180
DAGQAKMKKP QQRRRKKQMV TSVETDDDMN EGDDDDDGNG GGGGGVLGIE RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLIQV QTIAKDRGEK CPTKVSSKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A5e-35227289163PROTEIN LEAFY
2vy2_A5e-35227289163PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189197PQQRRRKKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6159370.0HQ615937.1 Brassica rapa LEAFYa (LFYa) mRNA, complete cds.
GenBankKR1904350.0KR190435.1 Brassica rapa subsp. pekinensis leafy 1 (LFY1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288996.10.0protein LEAFY
SwissprotQ009581e-134LFY_ARATH; Protein LEAFY
TrEMBLA0A078K3W70.0A0A078K3W7_BRANA; BnaCnng78500D protein
STRINGBra029305.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-119floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]